PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca30668.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 172aa    MW: 19671.2 Da    PI: 5.3779
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca30668.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.91.2e-4651191117
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeel+++yL kkv++  ++  +++++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+++ +g l
  Dca30668.1   5 LPPGFRFHPTDEELITFYLSKKVSDFGFTS-KAMADVDLNKCEPWDLPAKASMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKTTGKDKEIFR-GGIL 101
                 79*************************999.88***************999999****************************************.**** PP

         NAM 100 vglkktLvfykgrapkge 117
                 +g+kktLvfy+grapkg+
  Dca30668.1 102 IGMKKTLVFYRGRAPKGQ 119
                 ****************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-493119IPR003441NAC domain
PROSITE profilePS5100542.9485154IPR003441NAC domain
PfamPF023655.1E-226114IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MEEKLPPGFR FHPTDEELIT FYLSKKVSDF GFTSKAMADV DLNKCEPWDL PAKASMGEKE  60
WYFFSLRDRK YPTGLRTNRA TEAGYWKTTG KDKEIFRGGI LIGMKKTLVF YRGRAPKGQG  120
LLPPLGTELG SDFPSSSTEK AVDDQPMLSQ SEQQNPEQQQ FQEQPFNLDS IW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-43511820133NAC domain-containing protein 19
3swm_B2e-43511820133NAC domain-containing protein 19
3swm_C2e-43511820133NAC domain-containing protein 19
3swm_D2e-43511820133NAC domain-containing protein 19
3swp_A2e-43511820133NAC domain-containing protein 19
3swp_B2e-43511820133NAC domain-containing protein 19
3swp_C2e-43511820133NAC domain-containing protein 19
3swp_D2e-43511820133NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678450.16e-81PREDICTED: protein CUP-SHAPED COTYLEDON 1
SwissprotQ9FLR37e-67NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0J8CAG67e-81A0A0J8CAG6_BETVU; Uncharacterized protein
STRINGPOPTR_0012s05280.13e-76(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.15e-78NAC domain containing protein 58